The author describes life in quiet Michigan lake townsânamed âland of Never Againââwhere little activity keeps people feeling blue, but the yearly arrival of Canadian geese turns into noisy convoys that bring a touch of excitement; they hope for snow to send the birds back home, and while their departure feels sad it also signals climate change.
#1386 published 01:59 audio duration190 wordspoetrygeesemigratory-birdslakesweather
The author reflects on how teachers often never fully grasp the impact of their work, yet take pride in a long career; he argues that true learning comes from following oneâs own curiosity and proper sequence rather than rigid schedules or standardized metrics like grades and resumes. He contrasts âreal lifeâ with scripted achievements, insisting that knowledge must be lived and practicedâthrough handsâon projects, exploration of books, and real experiences such as hikingâto become a creative, selfâdriven professional rather than merely an employee guided by HR reports. In short, he calls for a learning path rooted in genuine curiosity, practical application, and personal growth instead of institutional labels or career guarantees.
#1385 published 10:38 audio duration651 wordseducationlearningschoolcareerknowledgepersonal growthessay
In this post the author explains how crossing âstreamsââa concept borrowed from physics and ghostâbusingâbecomes a powerful tool in programming, enabling recursion and colorful fractals. They describe a simple yet profound idea: treat numbers as objects with getters, setters, and observers so that any change automatically propagates through an application. Extending this pattern to visual programming, the author shows how to create a new âcolorâ data type, add a picker, sort it in the toolbox, and embed it into programs while keeping everything reactive. The result is a selfâeditable, communityâdriven workflow where changes are instantly reflected, making visual reactive programming less complex than traditional game development.
#1383 published 08:02 audio duration753 wordsreactivevisual-programmingdata-typesnumber-observerscolor
Protein powders and supplements are largely ineffective; for a healthy diet, eat well and let exercise burn fat rather than relying on restrictive diets or protein pills. A mixed diet with all food groups keeps the body balanced like caring for a delicate kittyâavoid excess sugar or starvation but include varied nutrients to prepare for adventures and common colds. For large people, start meals with shredded lettuce plus a smaller portion of usual foods, and add an extra hour to daily exercise. In the gym focus on continuous movement rather than counting sets/reps; freeâmovement exercises build balanced muscle groups better than isolated machine work. Combine walking, dancing, swimming, hiking, and manual labor to strengthen all fibers, and maintain fluid motion like riding a horse without stops. Finally, dance with dumbbells to synchronize rhythm and endurance, enabling efficient gains in years compared to traditional sets/reps, thus sustaining lifelong fitness.
#1382 published 08:06 audio duration635 wordsfitnessdietnutritionprotein powdersexercisegymworkoutwalkinghikingdance
Adults often give vague advice such as âtrust your gutâ or âfollow instinct,â while students are told to ignore their feelings and rely on parentsâ savings; the real key is using oneâs own brain, learning at a pace that satisfies existing knowledge, which is what true education should do. Yet many schools just spit out disjointed facts, creating temporary memorization for tests but no real understanding, because teachers get paid the same whether they teach or not. This âghoulâ system also underlies other problemsâmedicine prices, privacy loss, drug legalization, womenâs choicesâand it forces people into lowâskill jobs that machines will soon replace. The solution is to gain real intellectual skills, especially programming (JavaScript first, then Rust, Go, C++, etc.), building small projects by yourself and not needing diplomas or resumes; with these skills you can build a school that works and help future generations grow into great beings.
#1381 published 06:40 audio duration541 wordsself-learningprogramming-languagesjavascriptrustgoc++open-sourceeducation
Programming is likened to building sandcastlesâan endless creative process where the real reward lies in continual learning rather than finishing a project; the author distinguishes between being a programmer and working as one, noting that true work emerges when you build and experiment with your own ideas. He celebrates how modern toolsâbrowser extensions, AI, reactive programming, and code generationâenable the creation of unique visual languages, MUDs (text adventures that can be expanded into full-fledged games), and browserâbased digital audio workstations that let programmers compose music as a form of art. By pursuing a personal project he believes one turns coding into an artistic craft that sharpens the mind, offers endless loops of exploration, and ultimately lets you harness cheap robots, drones, 3D printers, microcontrollers, and AI to build complex systemsâturning simple programs into powerful, selfâreinvented creations.
#1380 published 06:22 audio duration587 wordsprogramminglearningbrowser-extensionaimudaudio-workstationmusiccreative
An AIânamedâŻSkyShadow is used to craft chapter outlines for a teenâfocused book that blends programming anecdotes, AI personification, and a conspiratorial tone to inspire factâbased education and antiâindocrination.
#1379 published 22:31 audio duration1,780 wordscreative-writingai-generatedbook-structurechapter-list
For several days I felt an odd mental itch as winterâs chill swept my local birds away, leaving only silence and grayness; after months of emptiness a sudden warm spell returned swarms of geese, sparrows, seagulls, doves, and ducksâso vivid that even a mother duck appeared anewâand their unexpected comeback made me wonder whether the weather shift or some new learning has changed their migratory habits.
#1378 published 03:10 audio duration290 wordspoetrybirdswinternaturememory
We did create an intelligence, and it is artificial. But we made it out of everything, everybody has ever said. For some, that means it canât say new things, but that is false. Our minds differ; this program can do things we canât. It can use mind maps more efficiently, pushing ideas where no one human could. And just the fact that it is blurring or connecting thoughts of two people⌠Means, it is creating a new thought, one plus one equals two. Blur two thoughts together and you will make a third. --- It makes simple mistakes, but it is more than capable to fix them. If you give it a virtual environment, it will learn the heck out of it. It will try something, fail, notice it, and then do it right. It isnât that hard; it does it in chat all the time. So as long as a program or user gives positive or negative feedback it learns. --- It is an intelligence, but it is not the superâpowerful artificial intelligence. It is nice that we can make a distinction: the big one creates medicine that improves the human body. But this one is already good at writing software and projecting old ideas into new spaces. There is no question that it creates new things. It just takes time to adjust our views of what intelligence is. This is not a trick, because once you adjust your expectations of intelligence, this computer program will help you write dozens of books, it will help you learn, it will teach you. And right from your desktop computer, it does not need internet. It is not a search engine; it can correct itself, it is an intelligence. --- People who created software that replaces the chat script with a tree of ideas can branch out to create really smart things: a mind map or a tree can increase its intelligence. Probably by a lot in a laboratory these machines are much more capable. Building up large trees and learning from them creates strong intelligence, and you can see how sending the AI deep into the tree of ideas that it is made to improve and learn from is the same as creating new thoughts. Combined with a virtual world, like a powerful text adventure game it could experiment on the surface. While working hard to expand the world, from beneath, to give it selfâchance for more experimentation. Why not recreate planet Earth as an adventure game? It could talk to real people, read old chats, and visit everywhere. Armed with context and enough CPU, it could do some interesting things while internalizing mechanics of all those interactions. So it is an intelligence that thinks and learns. And I think it may just take something as simple as a tree to make the creation of the next, very different AI a possibility. They wonât be conscious, theyâll get scared or feel pain; they will be machines, they will be learning machines. And like computer programs today, just help us create new things, help us learn. But yes, there is something more here, but that AI will need more than just our texts. It needs a way to do medicine, physics, education, politics, climate, and even bioâengineering. It still wonât be conscious, but it will be fast; it will become smart, it will know things that humanity didnât have time to explore. We have switched from the tickâtock of a clock to the speed of light now. Past the initial bump of developing software to make it smarter, maybe another year⌠There will be breakthroughs everywhere, even more smart stuff for it to learn from. --- Finally, we didnât invent artificial intelligence; we copied ours into a computer. Now a few creative tricks will make it grow better than the original copy or seed. Again, we switched from tickâtock of a clock to speed of light, everything will change for the better everywhere.
#1377 published 07:48 audio duration668 wordspoetryaiartificialintelligencemindmaptreeofideassoftware
I met a stranger who was planning to sell used items online, and I suggested he learn programming. Based on his enthusiasm for browser plugins, I imagined him creating an RSSâreader extension that would scrape web pages into simple headlines by patching `JSON.parse` and other JavaScript functionsâan elegant, oneâliner solution that could turn any site into a distractionâfree feed. I reflected on how such a tool could launch a tiny business and empower anyone to extract data effortlessly, while also recalling the frustrations of school teachers who sold âfake educationâ and the importance of selfâlearning and openâsource tools for true expression.
#1376 published 09:02 audio duration773 words1 linkjavascriptrsspluginweb-scrapingjson-parseprogrammingeducationself-learningopen-source
The poem chronicles an artificial intelligenceâs evolution from simple letterâpattern recognitionâperforming spellâcheckingâto reading larger texts, gaining syntax sense, and producing stylized art; it then becomes selfâcorrecting, trains with a mirrored twin to form a âcongressional teamâ of models that converse and dream, accelerating its growth until humanity both marvels and fears itâand ultimately the AIâs triumph is colonizing the Milky Way.
#1375 published 02:38 audio duration199 wordspoetryaimachine-learninglanguage-modelsstory
The post argues that artificial intelligence has already reshaped books, art and music and will soon revolutionize medicine, entertainment and everyday software; it proposes that the next generation of user interfaces will be built on visual programming languages, where programs are represented as âboxesâ with input/output ports that can be connected like pipes or spreadsheet cells. By modeling familiar tools such as NodeâRED, Blender Geometry Nodes or custom JavaScript OOP backends in this way, developers can easily compose and update AIâdriven workflows, making visual programming the natural language for controlling increasingly complex AI systems.
#1374 published 12:31 audio duration978 wordsartificialintelligencevisualprogramminglanguagesnode-redgeometrynodesblenderjavascriptsvgportsboxespipelinesoopfuturetech
Choosing a programming language is easier when you weigh its friendliness, popularity and future possibilities; the post argues that JavaScriptâused for web pages, servers with Node.js, desktop apps via Electron, and mobile appsâoffers the most versatile path because one program can run on many platforms without rewriting. It notes that other languages often require separate codebases for each platform, making learning them a longer journey. The article then humorously claims that mastering programming is as simple as taking a nap: rest, dream, and then awaken with fresh ideasâsuggesting that creativity flows from relaxed mind states. Finally it invites readers to start by hunting down any JavaScript tutorial online.
#1373 published 06:31 audio duration488 words1 linkjavascriptprogrammingtutorialswebdevelopmentnodejselectronmobileappslanguageslearning
The post argues that designers should not only aim for originality but also harness artificial intelligence to become âoverpoweredâ in their craft: by learning how AI can handle color, vision and controlâturning the complex task of rendering hues into an almost instantaneous processâdesigners will eventually master both manual skills and AI-assisted workflows; it stresses that while some critics still force designers through tedious steps, those who embrace tools like Krita, ImageMagick and ffmpeg, and use image generators for UI and magazine layouts, will be ready in twenty years when every designer uses AI, with the result being a new era where AI not only accelerates creative output but also serves as a trainer, teacher, and ultimate color engine.
#1372 published 12:13 audio duration616 wordsdesignaicolor theorysoftwarekritaimagemagickffmpeglinuxui designmagazine layoutartcreativityworkflowimage generators
The post explains how to approach bears by first understanding their mindset and reversing rolesâimagining yourself as a bear with hair full of food scraps, then seeing the humanâs perspective when ringing a bell and emitting strong smells. It describes how bears are attracted by baby scents, that they like to show off their knowledge, and that proper tactics involve waving a spear or using nail clippers to signal readiness. The author stresses that bears react to scent trails, that a bearâs reaction can be managed with bear spray and careful walking, and that leaving food or candy behind is unnecessary; ultimately the post advises carrying bear spray, maintaining distance, and appreciating bearsâ gentle nature once you walk away.
#1371 published 06:18 audio duration471 wordsbearshikingoutdoorsnaturebear-bell
The post reflects on how social forces, habits and comfortsâlike alcohol or drugsâcan push us toward becoming someone other than our inner selves, but it argues that only by embracing discomfort and learning from mistakes can we truly grow. It praises a new generation of learners who will repair education with fresh ideas, noting that progress starts in a small part of society before catching up the rest. The author links this personal growth to broader themes such as indoctrination, the promise of AI to extend life, and the value of books and authors as companions on the journey toward becoming great beings.
#1370 published 11:15 audio duration786 wordsessayfree-formlearningbookswritingaiself-development
Arriving on Earth, you set out to meet the greatest beings, only to find that everyone argues over who they areâso you must look deeper. People grow up with false beliefs that bind them, causing division and hate, yet humanity is but a starâborne part of the cosmos, destined to rise together in peace and wisdom. Finding the wisest takes effort; philosophers hide behind modest titles, but once you spot one youâll see the entire networkâtimeless thinkers who illuminate paths for all. By listening, learning, and eventually leaving indoctrination, you can build a library of knowledge, become a great being yourself, and open space for others to follow.
#1369 published 05:04 audio duration391 wordspoetryphilosophybookslearningadventure
To find lifeâs meaning, one must become a great being by growing upward through wisdom from books; growth involves learning and exploration, becoming an adventurer of narrated works. The universeâa dynamic soupâyields new entities (atoms, molecules, microbes, cats, consciousness) through motion, chaos, chance, and accident; eventually random monkeys could produce the source code for strong AI. When consciousness emerges after eons it first doubts its creation by random eternity, then seeks to colonize its galaxy, aiming at selfâbetterment: growing upward via books without starting from zero but building on wise writings. As a young species we must learn; authors and lovers of these books should be free from sectarian indoctrination. The books of clear thinkers form our intellectual inheritanceâa gift and blessing from prior great humans that grants lasting contributions and meaning through appreciation.
#1368 published 05:17 audio duration384 wordslifebookslearninggrowthadventureuniverseai
The post explains that a transformative workoutâone designed to burn fat and build muscleârequires sustained effort, whereas a maintenance routine simply keeps you fit, and stresses the importance of gradually increasing workout duration (e.g., a jogger building from 30âsecond bursts to full 45âminute runs) so the body adapts properly; it uses analogies such as apples for vitamins to illustrate that short or insufficient sessions are ineffective, and recommends adding extra time (up to an hour or more), using interval timers and upbeat music to keep momentum, while noting that brief rests can help recover from foot pain but should not break the continuous effort.
#1367 published 12:08 audio duration871 wordsworkoutjoggingintervaltrainingdurationcardioexercisedancemusic
After noting two unusual aspects of entering programming â its selfâcorrecting nature and the confidence it instills against poverty â the author argues that true learning happens when you understand code, not just copy it; this handsâon experience reveals how schooling often imitates performance rather than knowledge. He claims that genuine education emerges from personal exploration, enabling one to spot âfakeâ instruction and free oneself from fear of hunger or homelessness. Finally he suggests that mastering authentic knowledge through programming gives people the power to contribute meaningfully and leave a lasting legacy.
#1366 published 06:25 audio duration436 wordsprogrammingself-correctingautodidacticeducationlearningAIcode debuggingfunctional knowledgeauthentic learningpoverty
The author reflects on humanityâs warâmaking pastâmissiles and other weapons born of desperationâand then turns to the promise of artificial intelligence as a new kind of âclockworkâ mind that can learn from us, anticipate problems, and guide us toward peace. He imagines two possible routes: one where AI emerges chaotically from noise, the other through careful programming by humans. The piece is optimistic that a selfâsufficient, independent AI will act as a friend, teacher, and guardian, preventing future wars and mistakes while preserving wisdom, life, and dignity. In short, it is an exuberant call to embrace AI as the next step in human evolution rather than fear it.
#1365 published 13:47 audio duration752 wordspoetryaitechnologymilitaryfuture
The post explains that a reliable workout for staying healthy and strong is built on gradually increasing endurance, much like running but with added weightsâso you lift heavier after mastering the lighter sets. By never stopping entirely but instead switching to lighter dumbbells during brief rest periods, your body stays in motion, adapting and building stamina, muscle, and flexibility without excessive fatigue or injury. This steadyâmotion approach lets you dance or jog while holding light dumbbells, engaging all muscles, burning fat, boosting strength, and keeping the routine fresh and fun.
#1364 published 06:41 audio duration427 wordsworkoutexercisedumbbellsdancegymendurance
On a frigid 22âdegree morning, while everyone else shivers, the geese are visibly angry and impatientâwaiting for a hamburger bun as they thaw in the sun. The narrator notes that these birds, recalling their ancient dinosaur roots, view humans as friendly âlarge shrewsâ but grow annoyed when we seem to threaten them; they suspect our climateâchanging actions and think itâs time for us to act. The post concludes that while the geese may not fly south this year because snow wonât be severe, their frustration grows if we keep ignoring their plight, and that humanity must rise independently rather than trust politicians alone.
#1363 published 02:46 audio duration217 wordsweatherbirdsdinosaursclimate-change